SCOP 1.71: Domain d1k9da2: 1k9d A:5-142

Lineage for d1k9da2 (1k9d A:5-142)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries)

8. Domain d1k9da2: 1k9d A:5-142 [77293]
   Other proteins in same PDB: d1k9da1
   complexed with gol

Details for d1k9da2

PDB Entry: 1k9d, 1.7 Å

PDB Description: The 1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1

SCOP Domain Sequences for d1k9da2:

Sequence; same for both SEQRES and ATOM records:

>d1k9da2 d.92.2.2 (A:5-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus}
yepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevneta
nsiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflrl
lqmgeniaqlsiieqpkn

Timeline for d1k9da2:

• d1k9da2 first appeared in SCOP 1.63
  
• d1k9da2 appears in SCOP 1.69
  
• d1k9da2 appears in SCOP 1.73
  
• d1k9da2 appears in the current release, SCOPe 2.08