![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 |
![]() | Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [82740] (3 PDB entries) |
![]() | Domain d1k9da2: 1k9d A:5-142 [77293] Other proteins in same PDB: d1k9da1 complexed with gol |
PDB Entry: 1k9d (more details), 1.7 Å
SCOP Domain Sequences for d1k9da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9da2 d.92.2.2 (A:5-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus} yepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevneta nsiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflrl lqmgeniaqlsiieqpkn
Timeline for d1k9da2: