Lineage for d1k9da1 (1k9d A:143-679)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083545Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 protein domains)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2083546Protein alpha-D-glucuronidase catalytic domain [82254] (2 species)
    inverting reaction mechanism
  7. 2083547Species Bacillus stearothermophilus [TaxId:1422] [82256] (7 PDB entries)
  8. 2083550Domain d1k9da1: 1k9d A:143-679 [77292]
    Other proteins in same PDB: d1k9da2
    complexed with gol

Details for d1k9da1

PDB Entry: 1k9d (more details), 1.7 Å

PDB Description: The 1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1
PDB Compounds: (A:) alpha-d-glucuronidase

SCOPe Domain Sequences for d1k9da1:

Sequence, based on SEQRES records: (download)

>d1k9da1 c.1.8.10 (A:143-679) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
rlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdyarllasvginaisinnvnv
hktetklitdhflpdvaevadifrtygiktflsinyaspieigglptadpldpevrwwwk
etakriyqyipdfggfvvkadsefrpgpftygrdhaeganmlaealapfgglviwrcfvy
ncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrepvsplfgampktn
qmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidgslfdyrysgiag
vsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgddsqvvetiswml
lsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdgigvdrtvatgtg
ytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhiynthfegveqakql
rkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksgiddqygrkiyr

Sequence, based on observed residues (ATOM records): (download)

>d1k9da1 c.1.8.10 (A:143-679) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
rlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdyarllasvginaisinnvnv
hktetklitdhflpdvaevadifrtygiktflsinyaspieigglptadpldpevrwwwk
etakriyqyipdfggfvvkapgpftygrdhaeganmlaealapfgglviwrcfvyncqqd
wrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrepvsplfgampktnqmmev
qitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidgslfdyrysgiagvsnig
sdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgddsqvvetiswmllsswr
iyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdgigvdrtvatgtgytaqy
fpenaamyesldtcpdelllffhhvpythrlhsgetviqhiynthfegveqakqlrkrwe
qlkgkidekryhdvlerltiqvehakewrdvintyfyrksgiddqygrkiyr

SCOPe Domain Coordinates for d1k9da1:

Click to download the PDB-style file with coordinates for d1k9da1.
(The format of our PDB-style files is described here.)

Timeline for d1k9da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k9da2