Lineage for d1k91a1 (1k91 A:221-256)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409290Fold b.104: P-domain of calnexin/calreticulin [63886] (1 superfamily)
    non-globular proline-rich hairpin
  4. 2409291Superfamily b.104.1: P-domain of calnexin/calreticulin [63887] (1 family) (S)
  5. 2409292Family b.104.1.1: P-domain of calnexin/calreticulin [63888] (2 protein domains)
  6. 2409296Protein Calreticulin [63889] (1 species)
  7. 2409297Species Norway rat (Rattus norvegicus) [TaxId:10116] [63890] (3 PDB entries)
  8. 2409298Domain d1k91a1: 1k91 A:221-256 [77290]
    Other proteins in same PDB: d1k91a2

Details for d1k91a1

PDB Entry: 1k91 (more details)

PDB Description: Solution Structure of Calreticulin P-domain subdomain (residues 221-256)
PDB Compounds: (A:) calreticulin

SCOPe Domain Sequences for d1k91a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k91a1 b.104.1.1 (A:221-256) Calreticulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpehipdpdakkpedwdeemdgeweppviqnpeykg

SCOPe Domain Coordinates for d1k91a1:

Click to download the PDB-style file with coordinates for d1k91a1.
(The format of our PDB-style files is described here.)

Timeline for d1k91a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k91a2