Lineage for d1k8xb_ (1k8x B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591978Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 591979Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 591980Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 592114Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 592115Species Salmonella typhimurium [TaxId:90371] [53689] (33 PDB entries)
  8. 592126Domain d1k8xb_: 1k8x B: [77289]
    Other proteins in same PDB: d1k8xa_
    complexed with na, plp; mutant

Details for d1k8xb_

PDB Entry: 1k8x (more details), 1.9 Å

PDB Description: crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium

SCOP Domain Sequences for d1k8xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8xb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilk

SCOP Domain Coordinates for d1k8xb_:

Click to download the PDB-style file with coordinates for d1k8xb_.
(The format of our PDB-style files is described here.)

Timeline for d1k8xb_: