SCOP 1.63: Domain d1k8xb_: 1k8x B:

Lineage for d1k8xb_ (1k8x B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudodyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (31 PDB entries)

8. Domain d1k8xb_: 1k8x B: [77289]
   Other proteins in same PDB: d1k8xa_
   complexed with na, plp; mutant

Details for d1k8xb_

PDB Entry: 1k8x, 1.9 Å

PDB Description: crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium

SCOP Domain Sequences for d1k8xb_:

Sequence; same for both SEQRES and ATOM records:

>d1k8xb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilk

Timeline for d1k8xb_:

• d1k8xb_ is new in SCOP 1.63
  
• d1k8xb_ appears in SCOP 1.65
  
• d1k8xb_ appears in the current release, SCOPe 2.08