SCOP 1.73: Domain d1k87a1: 1k87 A:87-261

Lineage for d1k87a1 (1k87 A:87-261)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
   multihelical; array

4. Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (1 family)

5. Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)

6. Protein N-terminal domain of bifunctional PutA protein [81937] (1 species)
   includes the N-terminal swapping arm made of three helices; possible DNA-binding function

7. Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)

8. Domain d1k87a1: 1k87 A:87-261 [77286]
   Other proteins in same PDB: d1k87a2
   complexed with 1pe, fad, gol, lac, trs

Details for d1k87a1

PDB Entry: 1k87, 2 Å

PDB Description: Crystal structure of E.coli PutA (residues 1-669)

PDB Compounds: (A:) proline dehydrogenase

SCOP Domain Sequences for d1k87a1:

Sequence, based on SEQRES records:

>d1k87a1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records):

>d1k87a1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnrspslfvnaatwg
llftgneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Timeline for d1k87a1:

• d1k87a1 first appeared in SCOP 1.63
  
• d1k87a1 appears in SCOP 1.71
  
• d1k87a1 appears in SCOP 1.75
  
• d1k87a1 last appears in SCOPe 2.03