Lineage for d1k87a1 (1k87 A:87-261)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218890Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 218891Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (1 family) (S)
  5. 218892Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)
  6. 218893Protein N-terminal domain of bifunctional PutA protein [81937] (1 species)
    includes the N-terminal swapping arm made of three helices; possible DNA-binding function
  7. 218894Species Escherichia coli [TaxId:562] [81938] (1 PDB entry)
  8. 218895Domain d1k87a1: 1k87 A:87-261 [77286]
    Other proteins in same PDB: d1k87a2
    complexed with 1pe, fad, gol, lac, trs

Details for d1k87a1

PDB Entry: 1k87 (more details), 2 Å

PDB Description: Crystal structure of E.coli PutA (residues 1-669)

SCOP Domain Sequences for d1k87a1:

Sequence, based on SEQRES records: (download)

>d1k87a1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d1k87a1 a.176.1.1 (A:87-261) N-terminal domain of bifunctional PutA protein {Escherichia coli}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnrspslfvnaatwg
llftgneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

SCOP Domain Coordinates for d1k87a1:

Click to download the PDB-style file with coordinates for d1k87a1.
(The format of our PDB-style files is described here.)

Timeline for d1k87a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k87a2