SCOPe 2.05: Domain d1k85a_: 1k85 A:

Lineage for d1k85a_ (1k85 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Fibronectin type III domain from chitinase A1. [81975] (1 species)

7. Species Bacillus circulans [TaxId:1397] [81976] (1 PDB entry)

8. Domain d1k85a_: 1k85 A: [77285]

Details for d1k85a_

PDB Entry: 1k85

PDB Description: solution structure of the fibronectin type iii domain from bacillus circulans wl-12 chitinase a1.

PDB Compounds: (A:) chitinase a1

SCOPe Domain Sequences for d1k85a_:

Sequence; same for both SEQRES and ATOM records:

>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]}
hmaptaptnlastaqttssitlswtastdnvgvtgydvyngtalattvtgttatisglaa
dtsytftvkakdaagnvsaasnavsvkt

Timeline for d1k85a_:

• d1k85a_ first appeared in SCOP 1.63
  
• d1k85a_ appears in SCOPe 2.04
  
• d1k85a_ is called d1k85a1 in SCOPe 2.06
  
• d1k85a_ appears in the current release, SCOPe 2.08, called d1k85a1