Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Erwinia chrysanthemi [TaxId:556] [82735] (5 PDB entries) Protease C |
Domain d1k7ia2: 1k7i A:18-258 [77282] Other proteins in same PDB: d1k7ia1 complexed with ca, zn; mutant |
PDB Entry: 1k7i (more details), 1.59 Å
SCOP Domain Sequences for d1k7ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi} antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla hpgeynagegdpsyndavyaedsyqfsimsfwgenetgadynghyggapmiddiaaiqrl y
Timeline for d1k7ia2: