Lineage for d1k7ia2 (1k7i A:18-258)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415549Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 415550Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 415551Species Erwinia chrysanthemi [TaxId:556] [82735] (5 PDB entries)
    Protease C
  8. 415552Domain d1k7ia2: 1k7i A:18-258 [77282]
    Other proteins in same PDB: d1k7ia1
    complexed with ca, zn; mutant

Details for d1k7ia2

PDB Entry: 1k7i (more details), 1.59 Å

PDB Description: prtc from erwinia chrysanthemi: y228f mutant

SCOP Domain Sequences for d1k7ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi}
antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla
hpgeynagegdpsyndavyaedsyqfsimsfwgenetgadynghyggapmiddiaaiqrl
y

SCOP Domain Coordinates for d1k7ia2:

Click to download the PDB-style file with coordinates for d1k7ia2.
(The format of our PDB-style files is described here.)

Timeline for d1k7ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k7ia1