Lineage for d1k7ga2 (1k7g A:25-258)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963971Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2963972Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 2963973Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
    Protease C
  8. 2963977Domain d1k7ga2: 1k7g A:25-258 [77280]
    Other proteins in same PDB: d1k7ga1
    complexed with ca, po4, zn

Details for d1k7ga2

PDB Entry: 1k7g (more details), 2 Å

PDB Description: PrtC from Erwinia chrysanthemi
PDB Compounds: (A:) secreted protease C

SCOPe Domain Sequences for d1k7ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ga2 d.92.1.6 (A:25-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanltfkflqsv
ssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnytrdasgnl
dygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalglahpgeyna
gegdpsyndavyaedsyqfsimsywgenetgadynghyggapmiddiaaiqrly

SCOPe Domain Coordinates for d1k7ga2:

Click to download the PDB-style file with coordinates for d1k7ga2.
(The format of our PDB-style files is described here.)

Timeline for d1k7ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k7ga1