Lineage for d1k6mb2 (1k6m B:252-470)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398889Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 398890Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 398967Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)
  6. 398968Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
    bifunctional enzyme
  7. 398969Species Human (Homo sapiens) [TaxId:9606] [82454] (1 PDB entry)
  8. 398971Domain d1k6mb2: 1k6m B:252-470 [77278]
    Other proteins in same PDB: d1k6ma1, d1k6mb1
    complexed with atg, po4; mutant

Details for d1k6mb2

PDB Entry: 1k6m (more details), 2.4 Å

PDB Description: crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase

SCOP Domain Sequences for d1k6mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6mb2 c.60.1.4 (B:252-470) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Human (Homo sapiens)}
siylcrhgeselnirgriggdsglsvrgkqyayalanfiqsqgisslkvftsrmkrtiqt
aealgvpyeqfkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyedlv
qrlepvimelerqenvlvichqavmrcllayfldksseelpylkcplhtvlkltpvaygc
kvesiylnveavnthrekpenvditrepeealdtvpahy

SCOP Domain Coordinates for d1k6mb2:

Click to download the PDB-style file with coordinates for d1k6mb2.
(The format of our PDB-style files is described here.)

Timeline for d1k6mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k6mb1