Lineage for d1k6ma1 (1k6m A:39-251)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243188Family c.37.1.7: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52589] (1 protein)
  6. 243189Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52590] (2 species)
    bifunctional enzyme
  7. 243190Species Human (Homo sapiens) [TaxId:9606] [82398] (1 PDB entry)
  8. 243191Domain d1k6ma1: 1k6m A:39-251 [77275]
    Other proteins in same PDB: d1k6ma2, d1k6mb2

Details for d1k6ma1

PDB Entry: 1k6m (more details), 2.4 Å

PDB Description: crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase

SCOP Domain Sequences for d1k6ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6ma1 c.37.1.7 (A:39-251) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Human (Homo sapiens)}
nsptmvimvglpargktyistkltrylnfigtptkvfnlgqyrreavsyknyefflpdnm
ealqirkqcalaalkdvhnylsheeghvavfdatnttrerrslilqfakehgykvffies
icndpgiiaenirqvklgspdyidcdrekvledflkriecyevnyqpldeeldshlsyik
ifdvgtrymvnrvqdhiqsrtvyylmnihvtpr

SCOP Domain Coordinates for d1k6ma1:

Click to download the PDB-style file with coordinates for d1k6ma1.
(The format of our PDB-style files is described here.)

Timeline for d1k6ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k6ma2