Lineage for d1k61b_ (1k61 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305224Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2305325Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 2305326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)
  8. 2305328Domain d1k61b_: 1k61 B: [77271]
    protein/DNA complex

Details for d1k61b_

PDB Entry: 1k61 (more details), 2.1 Å

PDB Description: matalpha2 homeodomain bound to dna
PDB Compounds: (B:) Mating-type protein alpha-2

SCOPe Domain Sequences for d1k61b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k61b_ a.4.1.1 (B:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekti

SCOPe Domain Coordinates for d1k61b_:

Click to download the PDB-style file with coordinates for d1k61b_.
(The format of our PDB-style files is described here.)

Timeline for d1k61b_: