| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (11 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (21 proteins) |
| Protein mat alpha2 Homeodomain [46695] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries) |
| Domain d1k61b_: 1k61 B: [77271] |
PDB Entry: 1k61 (more details), 2.1 Å
SCOP Domain Sequences for d1k61b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k61b_ a.4.1.1 (B:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekti
Timeline for d1k61b_: