Lineage for d1k61a_ (1k61 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210248Family a.4.1.1: Homeodomain [46690] (21 proteins)
  6. 210294Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 210295Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)
  8. 210296Domain d1k61a_: 1k61 A: [77270]

Details for d1k61a_

PDB Entry: 1k61 (more details), 2.1 Å

PDB Description: matalpha2 homeodomain bound to dna

SCOP Domain Sequences for d1k61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit

SCOP Domain Coordinates for d1k61a_:

Click to download the PDB-style file with coordinates for d1k61a_.
(The format of our PDB-style files is described here.)

Timeline for d1k61a_: