Lineage for d1k4ta2 (1k4t A:431-640,A:713-765)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264081Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 264082Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 264123Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 264124Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 264125Species Human (Homo sapiens) [TaxId:9606] [56363] (7 PDB entries)
  8. 264126Domain d1k4ta2: 1k4t A:431-640,A:713-765 [77264]
    Other proteins in same PDB: d1k4ta1, d1k4ta3
    complexed with hg, pg4, ptr, tgp, ttc, ttg

Details for d1k4ta2

PDB Entry: 1k4t (more details), 2.1 Å

PDB Description: human dna topoisomerase i (70 kda) in complex with the poison topotecan and covalent complex with a 22 base pair dna duplex

SCOP Domain Sequences for d1k4ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4ta2 d.163.1.2 (A:431-640,A:713-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens)}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqrappktfXqialgtsklnyldpritvawckkwgvpie
kiynktqrekfawaidmadedyef

SCOP Domain Coordinates for d1k4ta2:

Click to download the PDB-style file with coordinates for d1k4ta2.
(The format of our PDB-style files is described here.)

Timeline for d1k4ta2: