Lineage for d1k4sa2 (1k4s A:201-430)
- Root: SCOP 1.63
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) 
Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
2 domains: alpha+beta and all-betaSuperfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) 
Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein) Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56744] (7 PDB entries) 
Domain d1k4sa2: 1k4s A:201-430 [77262]
Other proteins in same PDB: d1k4sa1
complexed with ido, ptr, spt
Details for d1k4sa2
PDB Entry: 1k4s (more details), 3.2 Å
PDB Description: human dna topoisomerase i in covalent complex with a 22 base pair dna duplex
SCOP Domain Sequences for d1k4sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4sa2 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens)}
qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln
SCOP Domain Coordinates for d1k4sa2:
Click to download the PDB-style file with coordinates for d1k4sa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k4sa2:
- d1k4sa2 is new in SCOP 1.63
- d1k4sa2 appears in SCOP 1.65
- d1k4sa2 appears in the current release, SCOPe 2.08
View in 3D
