Lineage for d1k4sa1 (1k4s A:431-632,A:708-765)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047274Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1047275Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1047364Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 1047365Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 1047366Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 1047379Domain d1k4sa1: 1k4s A:431-632,A:708-765 [77261]
    Other proteins in same PDB: d1k4sa2
    protein/DNA complex

Details for d1k4sa1

PDB Entry: 1k4s (more details), 3.2 Å

PDB Description: human dna topoisomerase i in covalent complex with a 22 base pair dna duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1k4sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4sa1 d.163.1.2 (A:431-632,A:708-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhXreenkqialgtsklnyldpritvawckkwgvpiekiy
nktqrekfawaidmadedyef

SCOPe Domain Coordinates for d1k4sa1:

Click to download the PDB-style file with coordinates for d1k4sa1.
(The format of our PDB-style files is described here.)

Timeline for d1k4sa1: