Lineage for d1k4mc_ (1k4m C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860402Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2860426Species Escherichia coli [TaxId:562] [82358] (2 PDB entries)
  8. 2860429Domain d1k4mc_: 1k4m C: [77260]
    complexed with cit, nad

Details for d1k4mc_

PDB Entry: 1k4m (more details), 1.9 Å

PDB Description: Crystal structure of E.coli nicotinic acid mononucleotide adenylyltransferase complexed to deamido-NAD
PDB Compounds: (C:) NaMN adenylyltransferase

SCOPe Domain Sequences for d1k4mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4mc_ c.26.1.3 (C:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]}
mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
atiirerlqngescedllpepvltyinqqglyr

SCOPe Domain Coordinates for d1k4mc_:

Click to download the PDB-style file with coordinates for d1k4mc_.
(The format of our PDB-style files is described here.)

Timeline for d1k4mc_: