Lineage for d1k4mb_ (1k4m B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312146Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 312272Family c.26.1.3: Adenylyltransferase [52397] (4 proteins)
  6. 312287Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (5 species)
  7. 312315Species Escherichia coli [TaxId:562] [82358] (2 PDB entries)
  8. 312317Domain d1k4mb_: 1k4m B: [77259]

Details for d1k4mb_

PDB Entry: 1k4m (more details), 1.9 Å

PDB Description: Crystal structure of E.coli nicotinic acid mononucleotide adenylyltransferase complexed to deamido-NAD

SCOP Domain Sequences for d1k4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4mb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli}
mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
atiirerlqngescedllpepvltyinqqglyr

SCOP Domain Coordinates for d1k4mb_:

Click to download the PDB-style file with coordinates for d1k4mb_.
(The format of our PDB-style files is described here.)

Timeline for d1k4mb_: