![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (5 proteins) |
![]() | Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [82358] (2 PDB entries) |
![]() | Domain d1k4ma_: 1k4m A: [77258] |
PDB Entry: 1k4m (more details), 1.9 Å
SCOP Domain Sequences for d1k4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli} mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis atiirerlqngescedllpepvltyinqqglyr
Timeline for d1k4ma_: