Lineage for d1k4kd_ (1k4k D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359548Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1359577Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species)
  7. 1359601Species Escherichia coli [TaxId:562] [82358] (2 PDB entries)
  8. 1359608Domain d1k4kd_: 1k4k D: [77257]
    complexed with xe

Details for d1k4kd_

PDB Entry: 1k4k (more details), 2 Å

PDB Description: crystal structure of e. coli nicotinic acid mononucleotide adenylyltransferase
PDB Compounds: (D:) Nicotinic acid mononucleotide adenylyltransferase

SCOPe Domain Sequences for d1k4kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4kd_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]}
mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
atiirerlqngescedllpepvltyinqqgly

SCOPe Domain Coordinates for d1k4kd_:

Click to download the PDB-style file with coordinates for d1k4kd_.
(The format of our PDB-style files is described here.)

Timeline for d1k4kd_: