SCOP 1.63: Domain d1k4kd_: 1k4k D:

Lineage for d1k4kd_ (1k4k D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (3 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (5 species)

7. Species Escherichia coli [TaxId:562] [82358] (2 PDB entries)

8. Domain d1k4kd_: 1k4k D: [77257]
   complexed with xe

Details for d1k4kd_

PDB Entry: 1k4k, 2 Å

PDB Description: crystal structure of e. coli nicotinic acid mononucleotide adenylyltransferase

SCOP Domain Sequences for d1k4kd_:

Sequence; same for both SEQRES and ATOM records:

>d1k4kd_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli}
mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
atiirerlqngescedllpepvltyinqqgly

Timeline for d1k4kd_:

• d1k4kd_ is new in SCOP 1.63
  
• d1k4kd_ appears in SCOP 1.65
  
• d1k4kd_ appears in the current release, SCOPe 2.08