Lineage for d1k41b_ (1k41 B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 254865Fold d.17: Cystatin-like [54402] (5 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 255033Superfamily d.17.4: NTF2-like [54427] (6 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 255097Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 255098Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 255111Species Pseudomonas putida [TaxId:303] [54437] (13 PDB entries)
  8. 255129Domain d1k41b_: 1k41 B: [77253]
    mutant

Details for d1k41b_

PDB Entry: 1k41 (more details), 2.2 Å

PDB Description: crystal structure of ksi y57s mutant

SCOP Domain Sequences for d1k41b_:

Sequence, based on SEQRES records: (download)

>d1k41b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafsrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnls

Sequence, based on observed residues (ATOM records): (download)

>d1k41b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafsrqgk
vracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevnl
s

SCOP Domain Coordinates for d1k41b_:

Click to download the PDB-style file with coordinates for d1k41b_.
(The format of our PDB-style files is described here.)

Timeline for d1k41b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k41a_