SCOPe 2.08: Domain d1k41b_: 1k41 B:

Lineage for d1k41b_ (1k41 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
   Uniprot P07445

8. Domain d1k41b_: 1k41 B: [77253]
   mutant

Details for d1k41b_

PDB Entry: 1k41, 2.2 Å

PDB Description: crystal structure of ksi y57s mutant

PDB Compounds: (B:) Ketosteroid Isomerase

SCOPe Domain Sequences for d1k41b_:

Sequence, based on SEQRES records:

>d1k41b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafsrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnls

Sequence, based on observed residues (ATOM records):

>d1k41b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafsrqgk
vracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevnl
s

Timeline for d1k41b_:

• d1k41b_ first appeared in SCOP 1.63
  
• d1k41b_ appears in SCOPe 2.07