SCOPe 2.08: Domain d1k3ya1: 1k3y A:81-222

Lineage for d1k3ya1 (1k3y A:81-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d1k3ya1: 1k3y A:81-222 [77245]
   Other proteins in same PDB: d1k3ya2, d1k3yb2
   complexed with gol, gtx

Details for d1k3ya1

PDB Entry: 1k3y, 1.3 Å

PDB Description: crystal structure analysis of human glutathione s-transferase with s- hexyl glutatione and glycerol at 1.3 angstrom

PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1k3ya1:

Sequence; same for both SEQRES and ATOM records:

>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d1k3ya1:

• d1k3ya1 first appeared in SCOP 1.63
  
• d1k3ya1 appears in SCOPe 2.07