Lineage for d1k3xa1 (1k3x A:125-213)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286743Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 286744Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 286762Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (2 proteins)
    contains 4 helices in the core
  6. 286782Protein Endonuclease VIII [81703] (1 species)
  7. 286783Species Escherichia coli [TaxId:562] [81704] (2 PDB entries)
  8. 286784Domain d1k3xa1: 1k3x A:125-213 [77242]
    Other proteins in same PDB: d1k3xa2, d1k3xa3
    complexed with bro, gol, ped, so4, zn

Details for d1k3xa1

PDB Entry: 1k3x (more details), 1.25 Å

PDB Description: Crystal structure of a trapped reaction intermediate of the DNA repair enzyme Endonuclease VIII with Brominated-DNA

SCOP Domain Sequences for d1k3xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3xa1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrg

SCOP Domain Coordinates for d1k3xa1:

Click to download the PDB-style file with coordinates for d1k3xa1.
(The format of our PDB-style files is described here.)

Timeline for d1k3xa1: