Lineage for d1k3wa3 (1k3w A:223-262)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 524023Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 524049Protein Endonuclease VIII [82917] (1 species)
  7. 524050Species Escherichia coli [TaxId:562] [82918] (5 PDB entries)
  8. 524052Domain d1k3wa3: 1k3w A:223-262 [77241]
    Other proteins in same PDB: d1k3wa1, d1k3wa2

Details for d1k3wa3

PDB Entry: 1k3w (more details), 1.42 Å

PDB Description: crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna

SCOP Domain Sequences for d1k3wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3wa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli}
alfrfkvfhrdgepcercgsiiekttlssrpfywcpgcqh

SCOP Domain Coordinates for d1k3wa3:

Click to download the PDB-style file with coordinates for d1k3wa3.
(The format of our PDB-style files is described here.)

Timeline for d1k3wa3: