Lineage for d1k3wa2 (1k3w A:1-124)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472160Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 472161Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 472162Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 472188Protein Endonuclease VIII [82233] (1 species)
  7. 472189Species Escherichia coli [TaxId:562] [82234] (5 PDB entries)
  8. 472191Domain d1k3wa2: 1k3w A:1-124 [77240]
    Other proteins in same PDB: d1k3wa1, d1k3wa3

Details for d1k3wa2

PDB Entry: 1k3w (more details), 1.42 Å

PDB Description: crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna

SCOP Domain Sequences for d1k3wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3wa2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli}
pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

SCOP Domain Coordinates for d1k3wa2:

Click to download the PDB-style file with coordinates for d1k3wa2.
(The format of our PDB-style files is described here.)

Timeline for d1k3wa2: