| Class b: All beta proteins [48724] (119 folds) |
| Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) ![]() |
| Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (2 proteins) |
| Protein Endonuclease VIII [82233] (1 species) |
| Species Escherichia coli [TaxId:562] [82234] (2 PDB entries) |
| Domain d1k3wa2: 1k3w A:1-124 [77240] Other proteins in same PDB: d1k3wa1, d1k3wa3 complexed with ped, so4, zn |
PDB Entry: 1k3w (more details), 1.42 Å
SCOP Domain Sequences for d1k3wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3wa2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli}
pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr
Timeline for d1k3wa2: