Lineage for d1k3wa1 (1k3w A:125-214)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449897Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 449898Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 449916Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 449942Protein Endonuclease VIII [81703] (1 species)
  7. 449943Species Escherichia coli [TaxId:562] [81704] (5 PDB entries)
  8. 449945Domain d1k3wa1: 1k3w A:125-214 [77239]
    Other proteins in same PDB: d1k3wa2, d1k3wa3

Details for d1k3wa1

PDB Entry: 1k3w (more details), 1.42 Å

PDB Description: crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna

SCOP Domain Sequences for d1k3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3wa1 a.156.1.2 (A:125-214) Endonuclease VIII {Escherichia coli}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrgq

SCOP Domain Coordinates for d1k3wa1:

Click to download the PDB-style file with coordinates for d1k3wa1.
(The format of our PDB-style files is described here.)

Timeline for d1k3wa1: