SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1k3oa1 (1k3o A:81-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996627Protein Class alpha GST [81349] (8 species)
  7. 1996640Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries)
    Uniprot P08263
  8. 1996663Domain d1k3oa1: 1k3o A:81-209 [77233]
    Other proteins in same PDB: d1k3oa2, d1k3ob2

Details for d1k3oa1

PDB Entry: 1k3o (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of apo Glutathione S-Transferase
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1k3oa1:

Sequence, based on SEQRES records: (download)

>d1k3oa1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

Sequence, based on observed residues (ATOM records): (download)

>d1k3oa1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllplalikekiknryfpafekvlkshgqdylvg
nklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqpgsprkppmd

SCOPe Domain Coordinates for d1k3oa1:

Click to download the PDB-style file with coordinates for d1k3oa1.
(The format of our PDB-style files is described here.)

Timeline for d1k3oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k3oa2