| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries) Uniprot P08263 |
| Domain d1k3lb2: 1k3l B:4-80 [77232] Other proteins in same PDB: d1k3la1, d1k3lb1 complexed with gtx |
PDB Entry: 1k3l (more details), 1.5 Å
SCOPe Domain Sequences for d1k3lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3lb2 c.47.1.5 (B:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
klvqtrailnyiaskyn
Timeline for d1k3lb2: