SCOPe 2.08: Domain d1k3lb2: 1k3l B:4-80

Lineage for d1k3lb2 (1k3l B:4-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries)
   Uniprot P08263

8. Domain d1k3lb2: 1k3l B:4-80 [77232]
   Other proteins in same PDB: d1k3la1, d1k3lb1
   complexed with gtx

Details for d1k3lb2

PDB Entry: 1k3l, 1.5 Å

PDB Description: Crystal Structure Analysis of S-hexyl-glutathione Complex of Glutathione Transferase at 1.5 Angstroms Resolution

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d1k3lb2:

Sequence; same for both SEQRES and ATOM records:

>d1k3lb2 c.47.1.5 (B:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
klvqtrailnyiaskyn

Timeline for d1k3lb2:

• d1k3lb2 first appeared in SCOP 1.63
  
• d1k3lb2 appears in SCOPe 2.07