Lineage for d1k1kb_ (1k1k B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977509Species Human (Homo sapiens) [TaxId:9606] [46501] (245 PDB entries)
    Uniprot P68871
  8. 1977711Domain d1k1kb_: 1k1k B: [77228]
    Other proteins in same PDB: d1k1ka_
    complexed with cmo, hem; mutant

Details for d1k1kb_

PDB Entry: 1k1k (more details), 2 Å

PDB Description: Structure of Mutant Human Carbonmonoxyhemoglobin C (beta E6K) at 2.0 Angstrom Resolution in Phosphate Buffer.
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1k1kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpkeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1k1kb_:

Click to download the PDB-style file with coordinates for d1k1kb_.
(The format of our PDB-style files is described here.)

Timeline for d1k1kb_: