Lineage for d1k19a_ (1k19 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2011374Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families) (S)
    automatically mapped to Pfam PF03392
  5. 2011375Family a.118.21.1: Chemosensory protein Csp2 [81898] (2 proteins)
  6. 2011376Protein Chemosensory protein Csp2 [81899] (1 species)
  7. 2011377Species Cabbage moth (Mamestra brassicae) [TaxId:55057] [81900] (5 PDB entries)
  8. 2011384Domain d1k19a_: 1k19 A: [77226]

Details for d1k19a_

PDB Entry: 1k19 (more details)

PDB Description: nmr solution structure of the chemosensory protein csp2 from moth mamestra brassicae
PDB Compounds: (A:) Chemosensory Protein CSP2

SCOPe Domain Sequences for d1k19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k19a_ a.118.21.1 (A:) Chemosensory protein Csp2 {Cabbage moth (Mamestra brassicae) [TaxId: 55057]}
edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee

SCOPe Domain Coordinates for d1k19a_:

Click to download the PDB-style file with coordinates for d1k19a_.
(The format of our PDB-style files is described here.)

Timeline for d1k19a_: