Lineage for d1k19a_ (1k19 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 216994Superfamily a.118.1: ARM repeat [48371] (12 families) (S)
  5. 217143Family a.118.1.12: Chemosensory protein Csp2 [81898] (1 protein)
  6. 217144Protein Chemosensory protein Csp2 [81899] (1 species)
  7. 217145Species Mamestra brassicae [TaxId:55057] [81900] (3 PDB entries)
  8. 217149Domain d1k19a_: 1k19 A: [77226]

Details for d1k19a_

PDB Entry: 1k19 (more details)

PDB Description: nmr solution structure of the chemosensory protein csp2 from moth mamestra brassicae

SCOP Domain Sequences for d1k19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k19a_ a.118.1.12 (A:) Chemosensory protein Csp2 {Mamestra brassicae}
edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee

SCOP Domain Coordinates for d1k19a_:

Click to download the PDB-style file with coordinates for d1k19a_.
(The format of our PDB-style files is described here.)

Timeline for d1k19a_: