SCOP 1.69: Domain d1k0wb_: 1k0w B:

Lineage for d1k0wb_ (1k0w B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.74: AraD-like aldolase/epimerase [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD-like aldolase/epimerase [53639] (1 family)

5. Family c.74.1.1: AraD-like aldolase/epimerase [53640] (4 proteins)
   metal (zinc)-ion dependent

6. Protein L-ribulose-5-phosphate 4-epimerase [69597] (1 species)

7. Species Escherichia coli [TaxId:562] [69598] (2 PDB entries)

8. Domain d1k0wb_: 1k0w B: [77221]

Details for d1k0wb_

PDB Entry: 1k0w, 2.1 Å

PDB Description: crystal structure of l-ribulose-5-phosphate 4-epimerase

SCOP Domain Sequences for d1k0wb_:

Sequence; same for both SEQRES and ATOM records:

>d1k0wb_ c.74.1.1 (B:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli}
mledlkrqvleanlalpkhnlvtltwgnvsavdrergvfvikpsgvdysimtaddmvvvs
ietgevvegakkpssdtpthrllyqafpsiggivhthsrhatiwaqagqsipatgtthan
yfygtipctrkmtdaeingeyewetgnvivetfekqgidaaqmpgvlvhshgpfawgkna
edavhnaivleevaymgifcrqlapqlpdmqqtllnkhylrkh

Timeline for d1k0wb_:

• d1k0wb_ first appeared in SCOP 1.63
  
• d1k0wb_ appears in SCOP 1.67
  
• d1k0wb_ appears in SCOP 1.71
  
• d1k0wb_ appears in the current release, SCOPe 2.08