Lineage for d1jysb_ (1jys B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246616Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 246632Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 246633Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)
  6. 246675Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (1 species)
  7. 246676Species Escherichia coli [TaxId:562] [82449] (1 PDB entry)
  8. 246678Domain d1jysb_: 1jys B: [77217]
    complexed with ade

Details for d1jysb_

PDB Entry: 1jys (more details), 1.9 Å

PDB Description: Crystal Structure of E. coli MTA/AdoHcy Nucleosidase

SCOP Domain Sequences for d1jysb_:

Sequence, based on SEQRES records: (download)

>d1jysb_ c.56.2.1 (B:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla

Sequence, based on observed residues (ATOM records): (download)

>d1jysb_ c.56.2.1 (B:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqsfdeflavaakqsslmveslvqkla

SCOP Domain Coordinates for d1jysb_:

Click to download the PDB-style file with coordinates for d1jysb_.
(The format of our PDB-style files is described here.)

Timeline for d1jysb_: