Lineage for d1jxnc_ (1jxn C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371305Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (2 PDB entries)
  8. 371310Domain d1jxnc_: 1jxn C: [77204]

Details for d1jxnc_

PDB Entry: 1jxn (more details), 2.3 Å

PDB Description: crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose

SCOP Domain Sequences for d1jxnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxnc_ b.29.1.1 (C:) Legume lectin {Furze (Ulex europaeus), UEA-I}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint

SCOP Domain Coordinates for d1jxnc_:

Click to download the PDB-style file with coordinates for d1jxnc_.
(The format of our PDB-style files is described here.)

Timeline for d1jxnc_: