Lineage for d1jxnb_ (1jxn B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794214Protein Legume lectin [49904] (23 species)
  7. 794326Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (2 PDB entries)
  8. 794330Domain d1jxnb_: 1jxn B: [77203]

Details for d1jxnb_

PDB Entry: 1jxn (more details), 2.3 Å

PDB Description: crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose
PDB Compounds: (B:) anti-H(O) lectin I

SCOP Domain Sequences for d1jxnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxnb_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint

SCOP Domain Coordinates for d1jxnb_:

Click to download the PDB-style file with coordinates for d1jxnb_.
(The format of our PDB-style files is described here.)

Timeline for d1jxnb_: