Lineage for d1jxna_ (1jxn A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226529Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 226650Protein Legume lectin [49904] (22 species)
  7. 226690Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (2 PDB entries)
  8. 226693Domain d1jxna_: 1jxn A: [77202]

Details for d1jxna_

PDB Entry: 1jxn (more details), 2.3 Å

PDB Description: crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose

SCOP Domain Sequences for d1jxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxna_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint

SCOP Domain Coordinates for d1jxna_:

Click to download the PDB-style file with coordinates for d1jxna_.
(The format of our PDB-style files is described here.)

Timeline for d1jxna_: