SCOPe 2.06: Domain d1jx7e1: 1jx7 E:802-917

Lineage for d1jx7e1 (1jx7 E:802-917)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.114: DsrEFH-like [75168] (1 superfamily)
3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
Superfamily c.114.1: DsrEFH-like [75169] (3 families)
Family c.114.1.1: DsrEF-like [75170] (6 proteins)
Pfam PF02635
Protein Hypothetical protein YchN [82369] (1 species)
Species Escherichia coli [TaxId:562] [82370] (1 PDB entry)
Domain d1jx7e1: 1jx7 E:802-917 [77199]
Other proteins in same PDB: d1jx7a2, d1jx7b2, d1jx7c2, d1jx7d2, d1jx7e2, d1jx7f2
structural genomics

Details for d1jx7e1

PDB Entry: 1jx7 (more details), 2.8 Å

PDB Description: Crystal structure of ychN protein from E.coli

PDB Compounds: (E:) hypothetical protein ychn

SCOPe Domain Sequences for d1jx7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jx7e1 c.114.1.1 (E:802-917) Hypothetical protein YchN {Escherichia coli [TaxId: 562]}
qkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyni
qqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf

SCOPe Domain Coordinates for d1jx7e1:

Click to download the PDB-style file with coordinates for d1jx7e1.
(The format of our PDB-style files is described here.)

Timeline for d1jx7e1: