SCOPe 2.05: Domain d1jx7b_: 1jx7 B:

Lineage for d1jx7b_ (1jx7 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.114: DsrEFH-like [75168] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215

4. Superfamily c.114.1: DsrEFH-like [75169] (3 families)

5. Family c.114.1.1: DsrEF-like [75170] (6 proteins)
   Pfam PF02635

6. Protein Hypothetical protein YchN [82369] (1 species)

7. Species Escherichia coli [TaxId:562] [82370] (1 PDB entry)

8. Domain d1jx7b_: 1jx7 B: [77196]
   structural genomics

Details for d1jx7b_

PDB Entry: 1jx7, 2.8 Å

PDB Description: Crystal structure of ychN protein from E.coli

PDB Compounds: (B:) hypothetical protein ychn

SCOPe Domain Sequences for d1jx7b_:

Sequence; same for both SEQRES and ATOM records:

>d1jx7b_ c.114.1.1 (B:) Hypothetical protein YchN {Escherichia coli [TaxId: 562]}
mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyn
iqqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf

Timeline for d1jx7b_:

• d1jx7b_ first appeared in SCOP 1.63
  
• d1jx7b_ appears in SCOPe 2.04
  
• d1jx7b_ is called d1jx7b1 in SCOPe 2.06
  
• d1jx7b_ appears in the current release, SCOPe 2.08, called d1jx7b1