SCOP 1.63: Domain d1jvsb2: 1jvs B:0-125,B:275-300

Lineage for d1jvsb2 (1jvs B:0-125,B:275-300)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (1 species)

7. Species Escherichia coli [TaxId:562] [69411] (2 PDB entries)

8. Domain d1jvsb2: 1jvs B:0-125,B:275-300 [77191]
   Other proteins in same PDB: d1jvsa1, d1jvsa3, d1jvsb1, d1jvsb3
   complexed with mse, ndp, so4

Details for d1jvsb2

PDB Entry: 1jvs, 2.2 Å

PDB Description: crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs

SCOP Domain Sequences for d1jvsb2:

Sequence; same for both SEQRES and ATOM records:

>d1jvsb2 c.2.1.3 (B:0-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankeXmrtpiahtmawpnrvnsgvkpldfck

Timeline for d1jvsb2:

• d1jvsb2 is new in SCOP 1.63
  
• d1jvsb2 appears in SCOP 1.65
  
• d1jvsb2 appears in the current release, SCOPe 2.08