Lineage for d1jvsa3 (1jvs A:126-274)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259192Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 259193Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 259348Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 259349Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (1 species)
  7. 259350Species Escherichia coli [TaxId:562] [69771] (2 PDB entries)
  8. 259351Domain d1jvsa3: 1jvs A:126-274 [77189]
    Other proteins in same PDB: d1jvsa1, d1jvsa2, d1jvsb1, d1jvsb2

Details for d1jvsa3

PDB Entry: 1jvs (more details), 2.2 Å

PDB Description: crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs

SCOP Domain Sequences for d1jvsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvsa3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
slvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltgs
ggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasqm
evlihpqsvihsmvryqdgsvlaqlgepd

SCOP Domain Coordinates for d1jvsa3:

Click to download the PDB-style file with coordinates for d1jvsa3.
(The format of our PDB-style files is described here.)

Timeline for d1jvsa3: