Lineage for d1jvsa2 (1jvs A:0-125,A:275-300)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238741Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 238742Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (1 species)
  7. 238743Species Escherichia coli [TaxId:562] [69411] (2 PDB entries)
  8. 238744Domain d1jvsa2: 1jvs A:0-125,A:275-300 [77188]
    Other proteins in same PDB: d1jvsa1, d1jvsa3, d1jvsb1, d1jvsb3

Details for d1jvsa2

PDB Entry: 1jvs (more details), 2.2 Å

PDB Description: crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs

SCOP Domain Sequences for d1jvsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvsa2 c.2.1.3 (A:0-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankeXmrtpiahtmawpnrvnsgvkpldfck

SCOP Domain Coordinates for d1jvsa2:

Click to download the PDB-style file with coordinates for d1jvsa2.
(The format of our PDB-style files is described here.)

Timeline for d1jvsa2: