Lineage for d1jvgb_ (1jvg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133233Protein UDP-N-acetylglucosamine pyrophosphorylase [75280] (3 species)
  7. 2133239Species Human (Homo sapiens), AGX2 [TaxId:9606] [82490] (2 PDB entries)
  8. 2133241Domain d1jvgb_: 1jvg B: [77186]
    complexed with ud2

Details for d1jvgb_

PDB Entry: 1jvg (more details), 2.3 Å

PDB Description: crystal structure of human agx2 complexed with udpgalnac
PDB Compounds: (B:) glcnac1p uridyltransferase

SCOPe Domain Sequences for d1jvgb_:

Sequence, based on SEQRES records: (download)

>d1jvgb_ c.68.1.5 (B:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX2 [TaxId: 9606]}
nindlkltlskagqehllrfwneleeaqqvelyaelqamnfeelnfffqkaiegfnqssh
qknvdarmepvprevlgsatrdqdqlqaweseglfqisqnkvavlllaggqgtrlgvayp
kgmydvglpsrktlfqiqaerilklqqvaekyygnkciipwyimtsgrtmestkefftkh
kyfglkkenviffqqgmlpamsfdgkiileeknkvsmapdgngglyralaaqnivedmeq
rgiwsihvycvdnilvkvadprfigfciqkgadcgakvvektnptepvgvvcrvdgvyqv
veyseislataqkrssdgrllfnagnianhfftvpflrdvvnvyepqlqhhvaqkkipyv
dtqgqlikpdkpngikmekfvfdifqfakkfvvyevlredefsplknadsqngkdnptta
rhalmslhhcwvlnagghfidengsrlpaiprsatngksetitadvnhnlkdandvpiqc
eisplisyageglesyvadkefhapliidengvhel

Sequence, based on observed residues (ATOM records): (download)

>d1jvgb_ c.68.1.5 (B:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX2 [TaxId: 9606]}
nindlkltlskagqehllrfwneleeaqqvelyaelqamnfeelnfffqkaiegfnvdar
mepvprevlgsatrdqdqlqaweseglfqisqnkvavlllaggqaypkgmydvglpsrkt
lfqiqaerilklqqvaekyygnkciipwyimtsgrtmestkefftkhkyfglkkenviff
qqgmlpamsfdgkiileeknkvsmapdgngglyralaaqnivedmeqrgiwsihvycvdn
ilvkvadprfigfciqkgadcgakvvektnptepvgvvcrvdgvyqvveyseislataqk
rssdgrllfnagnianhfftvpflrdvvnvyepqlqhhvaqkkipyvdtqgqlikpdkpn
gikmekfvfdifqfakkfvvyevlredefsplknadsqngkdnpttarhalmslhhcwvl
nagghfidengsrlpaiprvpiqceisplisyageglesyvadkefhapliidengvhel

SCOPe Domain Coordinates for d1jvgb_:

Click to download the PDB-style file with coordinates for d1jvgb_.
(The format of our PDB-style files is described here.)

Timeline for d1jvgb_: