SCOP 1.75: Domain d1jvba2: 1jvb A:144-313

Lineage for d1jvba2 (1jvb A:144-313)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries)

8. Domain d1jvba2: 1jvb A:144-313 [77182]
   Other proteins in same PDB: d1jvba1
   complexed with mse, zn

Details for d1jvba2

PDB Entry: 1jvb, 1.85 Å

PDB Description: alcohol dehydrogenase from the archaeon sulfolobus solfataricus

PDB Compounds: (A:) nad(h)-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1jvba2:

Sequence; same for both SEQRES and ATOM records:

>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd
vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnnsektlsvypkalak
qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk

Timeline for d1jvba2:

• d1jvba2 first appeared in SCOP 1.63
  
• d1jvba2 appears in SCOP 1.73
  
• d1jvba2 appears in SCOPe 2.01
  
• d1jvba2 appears in the current release, SCOPe 2.08